Recombinant Bovine Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial (MTHFD2) | CSB-EP606691BO

(No reviews yet) Write a Review
SKU:
CSB-EP606691BO
Availability:
13 - 23 Working Days
  • Recombinant Bovine Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial (MTHFD2)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Bovine Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial (MTHFD2) | CSB-EP606691BO | Cusabio

Alternative Name(s): NAD-dependent methylenetetrahydrofolate dehydrogenase Methenyltetrahydrofolate cyclohydrolase

Gene Names: MTHFD2

Research Areas: Metabolism

Organism: Bos taurus (Bovine)

AA Sequence: EAVVISGRKLAEQIKQEVRQEVEEWVASGNKRPHLSVVLVGENPASQSYVLNKTRAAASVGINSETILKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERKVCNAVSPDKDVDGFHVINVGRMCLDQCSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGAHERPGGDATVTISHRYTPKEELKKHTALADIVISAAGIPNLITADMIKEGAAVIDVGINRIQDPITAKPKLVGDVDFEGVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEQEVLKSKELGVASN

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 36-350aa

Sequence Info: Full Length of Mature Protein

MW: 49.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: 5,10-methylenetetrahydrofolate + NAD+ = 5,10-methenyltetrahydrofolate + NADH. 5,10-methenyltetrahydrofolate + H2O = 10-formyltetrahydrofolate.

Reference: NIH - Mammalian Gene Collection (MGC) project Submitted (AUG-2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Although its dehydrogenase activity is NAD-specific, it can also utilize NADP at a reduced efficiency.

Involvement in disease:

Subcellular Location: Mitochondrion

Protein Families: Tetrahydrofolate dehydrogenase/cyclohydrolase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q0P5C2

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose