Recombinant Bovine Angiogenin-1 (ANG1) | CSB-RP146794B

Recombinant Bovine Angiogenin-1 (ANG1) | CSB-RP146794B | Cusabio

Alternative Name(s): ANG1; ANGAngiogenin-1; EC 3.1.27.-

Gene Names: ANG1

Research Areas: Others

Organism: Bos taurus (Bovine)

AA Sequence: AQDDYRYIHFLTQHYDAKPKGRNDEYCFNMMKNRRLTRPCKDRNTFIHGNKNDIKAICEDRNGQPYRGDLRISKSEFQITICKHKGGSSRPPCRYGATEDSRVIVVGCENGLPVHFDESFITPRH

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-148aa

Sequence Info: Full Length of Mature Protein

MW: 18.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assbly of stress granules (SGs) . Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Has very low ribonuclease activity.

Reference: Solution structure of bovine angiogenin by 1H nuclear magnetic resonance spectroscopy.Lequin O., Albaret C., Bontems F., Spik G., Lallemand J.-Y.Biochemistry 35:8870-8880(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds to actin on the surface of endothelial cells; once bound, angiogenin is endocytosed and translocated to the nucleus. Stimulates ribosomal RNA synthesis including that containing the initiation site sequences of 45S rRNA. Cleaves tRNA within anticodon loops to produce tRNA-derived stress-induced fragments (tiRNAs) which inhibit protein synthesis and triggers the assembly of stress granules (SGs) (By similarity). Angiogenin induces vascularization of normal and malignant tissues. Angiogenic activity is regulated by interaction with RNH1 in vivo. Has very low ribonuclease activity.

Involvement in disease:

Subcellular Location: Cytoplasmic vesicle, secretory vesicle lumen, Secreted, Nucleus, nucleolus

Protein Families: Pancreatic ribonuclease family

Tissue Specificity: Serum and milk.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10152

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: N/A

STRING Database Link: STRING

OMIM Database Link: N/A