Cusabio Bos taurus Recombinants
Recombinant Bovine Agouti-signaling protein (ASIP) | CSB-BP639982BO
- SKU:
- CSB-BP639982BO
- Availability:
- 3 - 7 Working Days
Description
Recombinant Bovine Agouti-signaling protein (ASIP) | CSB-BP639982BO | Cusabio
Alternative Name(s): Agouti switch protein (ASP)
Gene Names: ASIP
Research Areas: Neuroscience
Organism: Bos taurus (Bovine)
AA Sequence: HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC
Source: Baculovirus
Tag Info: N-terminal 10xHis-tagged
Expression Region: 23-133aa
Sequence Info: Full Length of Mature Protein
MW: 14.9
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis and thus increasing synthesis of pheomelanin .
Reference: "Agouti variation within wild-type coat color in cattle is not dependent on changes in the coding sequence of the ASIP gene." Royo L.J., Alvarez I., Fernandez I., Arranz J.J., Gomez E., Goyache F. Submitted (JUL-2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q29414
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A