Recombinant Bordetella pertussis Serotype 3 fimbrial subunit (fim3) | CSB-YP322971BUA

Recombinant Bordetella pertussis Serotype 3 fimbrial subunit (fim3) | CSB-YP322971BUA | Cusabio

Alternative Name(s): fim3; BP1568; Serotype 3 fimbrial subunit

Gene Names: fim3

Research Areas: Others

Organism: Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

AA Sequence: NDGTIVITGSISDQTCVIEEPSTLNHIKVVQLPKISKNALRNDGDTAGATPFDIKLKECPQALGALKLYFEPGITTNYDTGDLIAYKQTYNASGNGNLSTVSSATKAKGVEFRLANLNGQHIRMGTDKTTQAAQTFTGKVTNGSKSYTLRYLASYVKKPKEDVDAAQITSYVGFSVVYP

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 26-204aa

Sequence Info: Full Length of Mature Protein

MW: 21.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.

Reference: "Structure of the Bordetella pertussis gene coding for the serotype 3 fimbrial subunit." Mooi F.R., Ter Avest A., van der Heide H.G.J. FEMS Microbiol. Lett. 54:327-331(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.

Involvement in disease:

Subcellular Location: Fimbrium

Protein Families: Fimbrial protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17835

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A