Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5) | CSB-EP527280BTN

Recombinant Blomia tropicalis Mite allergen Blo t 5 (BLOT5) | CSB-EP527280BTN | Cusabio

Alternative Name(s): Allergen: Blo t 5

Gene Names: BLOT5

Research Areas: Others

Organism: Blomia tropicalis (Mite)

AA Sequence: MKFAIVLIACFAASVLAQEHKPKKDDFRNEFDHLLIEQANHAIEKGEHQLLYLQHQLDELNENKSKELQEKIIRELDVVCAMIEGAQGALERELKRTDLNILERFNYEEAQTLSKILLKDLKETEQKVKDIQTQ

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-134aa

Sequence Info: Full Length

MW: 31.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Sensitization to Blomia tropicalis in patients with asthma and identification of allergen Blo t 5."Arruda L.K., Vailes L.D., Platts-Mills T.A.E., Fernandez-Caldas E., Montealegre F., Lin K.-L., Chua K.-Y., Rizzo M.C., Naspitz C.K., Chapman M.D.Am. J. Respir. Crit. Care Med. 155:343-350(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Mite group 5 allergen family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O96870

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A