Cusabio Virus & Bacteria Recombinants
Recombinant Betula pendula Profilin (BETVII) | CSB-EP335151BSS
- SKU:
- CSB-EP335151BSS
- Availability:
- 13 - 23 Working Days
Description
Recombinant Betula pendula Profilin (BETVII) | CSB-EP335151BSS | Cusabio
Alternative Name(s): Allergen Bet v II Pollen allergen Bet v 2 Allergen: Bet v 2
Gene Names: BETVII
Research Areas: Allergen
Organism: Betula pendula (European white birch) (Betula verrucosa)
AA Sequence: SWQTYVDEHLMCDIDGQASNSLASAIVGHDGSVWAQSSSFPQFKPQEITGIMKDFEEPGHLAPTGLHLGGIKYMVIQGEAGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMVVERLGDYLIDQGL
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 2-133aa
Sequence Info: Full Length of Mature Protein
MW: 30.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
Reference: "Analysis of the effects of polymorphism on pollen profilin structural functionality and the generation of conformational, T- and B-cell epitopes."Jimenez-Lopez J.C., Rodriguez-Garcia M.I., Alche J.D.PLoS ONE 8:E76066-E76066(2013)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Binds to actin and affects the structure of the cytoskeleton. At high concentrations, profilin prevents the polymerization of actin, whereas it enhances it at low concentrations. By binding to PIP2, it inhibits the formation of IP3 and DG.
Involvement in disease:
Subcellular Location: Cytoplasm, cytoskeleton
Protein Families: Profilin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P25816
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A