Recombinant Bauhinia ungulata Factor Xa inhibitor BuXI (BuXI) | CSB-YP307110BFM

(No reviews yet) Write a Review
SKU:
CSB-YP307110BFM
Availability:
25 - 35 Working Days
  • Recombinant Bauhinia ungulata Factor Xa inhibitor BuXI (BuXI)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $2,427.60

Description

Recombinant Bauhinia ungulata Factor Xa inhibitor BuXI (BuXI) | CSB-YP307110BFM | Cusabio

Alternative Name(s): Factor Xa inhibitor BuXI

Gene Names: BuXI

Research Areas: Others

Organism: Bauhinia ungulata (Orchid tree)

AA Sequence: DIVLDTDGKPVNNGGQYYIIPAFRGNGGGLELTRVGRETCPHTVVQASSEISNGLPVMIAALPRTMFISTAWRVSIQFLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPLEFRIEKVSEDAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEANQDSE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-172aa

Sequence Info: Full Length

MW: 21.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Inhibits bovine trypsin and chymotrypsin, and human plasmin, plasma kallikrein, factor XIIa and factor Xa.

Reference: Kinetic characterization of factor Xa binding using a quenched fluorescent substrate based on the reactive site of factor Xa inhibitor from Bauhinia ungulata seeds.Oliva M.L.V., Andrade S.A., Juliano M.A., Sallai R.C., Torquato R.J., Sampaio M.U., Pott V.J., Sampaio C.A.M.Curr. Med. Chem. 10:1085-1093(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Inhibits bovine trypsin and chymotrypsin, and human plasmin, plasma kallikrein, factor XIIa and factor Xa.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P83594

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose