Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial | CSB-EP528987BRS

Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial | CSB-EP528987BRS | Cusabio

Alternative Name(s): 132KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF(b)

Gene Names: cry1Fb

Research Areas: Others

Organism: Bacillus thuringiensis subsp. morrisoni

AA Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 984-1169aa

Sequence Info: Partial

MW: 47.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.

Reference: A novel cry1Fb gene from Bacillus thuringiensis subsp. morrisoni.Song F., Zhang J., Ding Z., Chen Z., Li G., Huang D.Masuda K., Asano S.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.

Involvement in disease:

Subcellular Location:

Protein Families: Delta endotoxin family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O66377

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A