Cusabio Other Organism Recombinants
Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial | CSB-EP528987BRS
- SKU:
- CSB-EP528987BRS
- Availability:
- 13 - 23 Working Days
Description
Recombinant Bacillus thuringiensis subsp. Pesticidal crystal protein cry1Fb (cry1Fb), partial | CSB-EP528987BRS | Cusabio
Alternative Name(s): 132KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIF(b)
Gene Names: cry1Fb
Research Areas: Others
Organism: Bacillus thuringiensis subsp. morrisoni
AA Sequence: VKGHVDVEEQNNHRSVLVVPEWEAEVSQEVRVCPGRGYILRVTAYKEGYGEGCVTIHEVDNNTDELKFSSNCEKEQVYPGNTVACNDYNKNHGANACSSRNGGYDESYESNSSIPADYAPVYEEEAYTDGQRGNPCEFNRGHTPLPAGYVTAELEYFPETDTVWVEIGETEGTFIVDSVELLLMEE
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 984-1169aa
Sequence Info: Partial
MW: 47.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.
Reference: A novel cry1Fb gene from Bacillus thuringiensis subsp. morrisoni.Song F., Zhang J., Ding Z., Chen Z., Li G., Huang D.Masuda K., Asano S.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Promotes colloidosmotic lysis by binding to the midgut epithelial cells of insects.
Involvement in disease:
Subcellular Location:
Protein Families: Delta endotoxin family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O66377
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A