Recombinant Bacillus thuringiensis subsp. kurstaki N-acyl homoserine lactonase AiiA (aiiA) | CSB-EP315623BDC

(No reviews yet) Write a Review
SKU:
CSB-EP315623BDC
Availability:
3 - 7 Working Days
  • Recombinant Bacillus thuringiensis subsp. kurstaki N-acyl homoserine lactonase AiiA (aiiA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Bacillus thuringiensis subsp. kurstaki N-acyl homoserine lactonase AiiA (aiiA) | CSB-EP315623BDC | Cusabio

Alternative Name(s): AHL-lactonase AiiA

Gene Names: aiiA

Research Areas: Others

Organism: Bacillus thuringiensis subsp. Kurstaki

AA Sequence: MTVKKLYFIPAGRCMLDHSSVNSALTPGKLLNLPVWCYLLETEEGPILVDTGMPESAVNNEGLFNGTFVEGQILPKMTEEDRIVNILKRVGYEPDDLLYIISSHLHFDHAGGNGAFTNTPIIVQRTEYEAALHREEYMKECILPHLNYKIIEGDYEVVPGVQLLYTPGHSPGHQSLFIETEQSGSVLLTIDASYTKENFEDEVPFAGFDPELALSSIKRLKEVVKKEKPIIFFGHDIEQEKSCRVFPEYI

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-250aa

Sequence Info: Full Length

MW: 35.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Catalyzes hydrolysis of N-hexanoyl-(S)-homoserine lactone, but not the R-enantiomer. Hydrolyzes short- and long-chain N-acyl homoserine lactones with or without 3-oxo substitution at C3, has maximum activity on C10-AHL.

Reference: "The molecular structure and catalytic mechanism of a quorum-quenching N-acyl-L-homoserine lactone hydrolase." Kim M.H., Choi W.C., Kang H.O., Lee J.S., Kang B.S., Kim K.J., Derewenda Z.S., Oh T.K., Lee C.H., Lee J.K. Proc. Natl. Acad. Sci. U.S.A. 102:17606-17611(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P0CJ63

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose