Recombinant Bacillus sp. Levanase, partial | CSB-EP523248BRG

Recombinant Bacillus sp. Levanase, partial | CSB-EP523248BRG | Cusabio

Alternative Name(s): 2,6-beta-D-fructan fructanohydrolase Endo-levanase

Gene Names: N/A

Research Areas: Others

Organism: Bacillus sp. (strain L7)

AA Sequence: LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 451-579aa

Sequence Info: Partial

MW: 30.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Reference: "Characterization of a novel endo-levanase and its gene from Bacillus sp. L7."Miasnikov A.N.FEMS Microbiol. Lett. 154:23-28(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Glycosyl hydrolase 32 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O31411

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A