Recombinant Bacillus pumilus Cell division protein ZapA (zapA) | CSB-EP423441BOL

(No reviews yet) Write a Review
SKU:
CSB-EP423441BOL
Availability:
13 - 23 Working Days
  • Recombinant Bacillus pumilus Cell division protein ZapA (zapA)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Bacillus pumilus Cell division protein ZapA (zapA) | CSB-EP423441BOL | Cusabio

Alternative Name(s): Z ring-associated protein ZapA

Gene Names: zapA

Research Areas: Others

Organism: Bacillus pumilus (strain SAFR-032)

AA Sequence: MSDGGKTKTTVEIYGQSYTIIGQETKMHMRHVASIVDDKMREINEKNPYLDINKLAVLTAVNVVHDYLKLKEQYEKLEIQLKEKE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-85aa

Sequence Info: Full Length

MW: 25.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division.

Reference: "Paradoxical DNA repair and peroxide resistance gene conservation in Bacillus pumilus SAFR-032."Gioia J., Yerrapragada S., Qin X., Jiang H., Igboeli O.C., Muzny D., Dugan-Rocha S., Ding Y., Hawes A., Liu W., Perez L., Kovar C., Dinh H., Lee S., Nazareth L., Blyth P., Holder M., Buhay C. Weinstock G.M.PLoS ONE 2:E928-E928(2007)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: ZapA family, Type 2 subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A8FG14

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose