Recombinant Avian infectious bronchitis virus Nucleoprotein (N) | CSB-MP737394AEAZ

(No reviews yet) Write a Review
SKU:
CSB-MP737394AEAZ
Availability:
3 - 7 Working Days
  • Recombinant Avian infectious bronchitis virus Nucleoprotein (N)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£423.20 - £4,116.00

Description

Recombinant Avian infectious bronchitis virus Nucleoprotein (N) | CSB-MP737394AEAZ | Cusabio

Alternative Name(s): Nucleocapsid protein;NC;Protein N

Gene Names: N

Research Areas: Microbiology

Organism: Avian infectious bronchitis virus (strain Arkansas 99) (IBV)

AA Sequence: MASGKATGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKAKKLNSHPPKFEGSGVPDNENLKTSQQHGYWRRQARFKPVKGGRKPVPDAWYFYYTGTGPAADLNWGDSQDGIVWVAAKGADVKSRSHQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRAPSRDGSRGRRSGSEDDLIARAAKIIQDQQKKGSRITKVKADEMAHRRYCKRTIPPGYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRSSSRPATRTSSPAPRQQRPKKEKKPKKQDDEVDKALTSNEERNNAQLEFDEEPKVINWGDSALGENEL

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 1-409aa

Sequence Info: Full Length

MW: 47.4 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.

Reference: "Nucleocapsid gene sequence analysis of several strains of infectious bronchitis virus describing the evolutionary relationship of IBV within the coronaviridae family." Williams A.K., Wang L., Sneed L.S., Collisson E.W. Submitted (MAR-1996) to the EMBL/GenBank/DDBJ databases

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q64960

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose