Cusabio Virus & Bacteria Recombinants
Recombinant Avena sativa Endochitinase, partial | CSB-YP308852DPO
- SKU:
- CSB-YP308852DPO
- Availability:
- 25 - 35 Working Days
Description
Recombinant Avena sativa Endochitinase, partial | CSB-YP308852DPO | Cusabio
Alternative Name(s): Endochitinase; EC 3.2.1.14; Fragments
Gene Names: N/A
Research Areas: Others
Organism: Avena sativa (Oat)
AA Sequence: VSSVISSSLFEKMLLHRGFYTYDAFIAAAKSFPAFATTGSTDVRKREVAAFLAQTSHETTGGWPTAPDGPYELGSTSDYFGRGPIQISYNYNYGAAGKAIGVDLLRNPDLVTSDNTVEFKTALWFWMTPQSPKPSSHDVITGRWSPSSTDKAAGRVPGYGVLTNIIDGGVECGKGQESHVADRIGYYKDNLDCYNQKPFA
Source: Yeast
Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-200aa
Sequence Info: Partial
MW: 25.2 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: This protein functions as a defense against chitin-containing fungal pathogens
Reference: "Oat (Avena sativa) seed extract as an antifungal food preservative through the catalytic activity of a highly abundant class I chitinase." Sorensen H.P., Madsen L.S., Petersen J., Andersen J.T., Hansen A.M., Beck H.C. Appl. Biochem. Biotechnol. 160:1573-1584(2010)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: This protein functions as a defense against chitin-containing fungal pathogens.
Involvement in disease:
Subcellular Location:
Protein Families: Glycosyl hydrolase 19 family, Chitinase class I subfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P86181
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A