Recombinant Aspergillus niger Probable alpha-galactosidase B (aglB) | CSB-EP381525AVE

(No reviews yet) Write a Review
SKU:
CSB-EP381525AVE
Availability:
13 - 23 Working Days
  • Recombinant Aspergillus niger Probable alpha-galactosidase B (aglB)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Aspergillus niger Probable alpha-galactosidase B (aglB) | CSB-EP381525AVE | Cusabio

Alternative Name(s): Melibiase B

Gene Names: aglB

Research Areas: Others

Organism: Aspergillus niger (strain CBS 513.88 / FGSC A1513)

AA Sequence: DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDMLEVGNGNLTLPENRAHFALWAMMKAPLIIGTPLDSIDTSHLTILSNKPLLTFHQDAVIGRPAYPYKWGYNPDWTFDPEHPAEYWSGPTSSGEVFVLMLNSEGEVKTRSAVWEEVPELKDRGTKKNSKEKKGFKVTDAWTGKDLGCVKDKYEVKLQAHDVAVLVVGGQC

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 21-443aa

Sequence Info: Full Length of Mature Protein

MW: 62.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Hydrolyzes a variety of simple alpha-D-galactoside as well as more complex molecules such as oligosaccharides and polysaccharides.

Reference: Differential expression of three alpha-galactosidase genes and a single beta-galactosidase gene from Aspergillus niger.de Vries R.P., van den Broeck H.C., Dekkers E., Manzanares P., de Graaff L.H., Visser J.Appl. Environ. Microbiol. 65:2453-2460(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Hydrolyzes a variety of simple alpha-D-galactoside as well as more complex molecules such as oligosaccharides and polysaccharides.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Glycosyl hydrolase 27 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A2QEJ9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose