Recombinant Aspergillus niger Aspergillopepsin-2?partial | CSB-EP338616DOZ

(No reviews yet) Write a Review
SKU:
CSB-EP338616DOZ
Availability:
3 - 7 Working Days
  • Recombinant Aspergillus niger Aspergillopepsin-2?partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Aspergillus niger Aspergillopepsin-2?partial | CSB-EP338616DOZ | Cusabio

Alternative Name(s): Acid protease A Aspergillopepsin II Proctase A

Gene Names: N/A

Research Areas: Microbiology

Organism: Aspergillus niger

AA Sequence: EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 60-98aa

Sequence Info: Partial

MW: 19.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "The gene and deduced protein sequences of the zymogen of Aspergillus niger acid proteinase A."Inoue H., Kimura T., Makabe O., Takahashi K.J. Biol. Chem. 266:19484-19489(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: Peptidase G1 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P24665

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose