Recombinant Aspergillus japonicus Superoxide dismutase [Cu-Zn] (sodC), partial | CSB-EP619615DOY

(No reviews yet) Write a Review
SKU:
CSB-EP619615DOY
Availability:
13 - 23 Working Days
  • Recombinant Aspergillus japonicus Superoxide dismutase [Cu-Zn] (sodC), partial
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP619615DOY could indicate that this peptide derived from E.coli-expressed Aspergillus japonicus sodC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP619615DOY could indicate that this peptide derived from E.coli-expressed
£281.60 - £1,361.60

Description

Recombinant Aspergillus japonicus Superoxide dismutase [Cu-Zn] (sodC), partial | CSB-EP619615DOY | Cusabio

Alternative Name(s): sodC; Superoxide dismutase [Cu-Zn]; EC 1.15.1.1; Fragment

Gene Names: sodC

Research Areas: Cancer

Organism: Aspergillus japonicus

AA Sequence: NSSSVPLHGFHVHALGDTTNGCMSTGPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHADPDDLGKGGHELSKTTGNSNSSMDSCAHGIQGIL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-120aa

Sequence Info: Partial

MW: 19.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Reference: "Cloning and characterization of a copper/zinc-superoxide dismutase gene from Aspergillus japonicus." Lin C.T., Lin M.T., Sheu D.C., Duan K.J. Taiwania 39:73-79(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Cu-Zn superoxide dismutase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q12548

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose