Recombinant Artemisia vulgaris Major pollen allergen Art v 1 | CSB-EP774628AOH

Recombinant Artemisia vulgaris Major pollen allergen Art v 1 | CSB-EP774628AOH | Cusabio

Alternative Name(s): Defensin-like protein 1 Allergen: Art v 1

Gene Names: N/A

Research Areas: Others

Organism: Artemisia vulgaris (Mugwort)

AA Sequence: AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-132aa

Sequence Info: Full Length of Mature Protein

MW: 26.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Art v 1, the major allergen of mugwort pollen, is a modular glycoprotein with a defensin-like and a hydroxyproline-rich domain."Himly M., Jahn-Schmid B., Dedic A., Kelemen P., Wopfner N., Altmann F., van Ree R., Briza P., Richter K., Ebner C., Ferreira F.FASEB J. 17:106-108(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: DEFL family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q84ZX5

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A