Cusabio Virus & Bacteria Recombinants
Recombinant Artemisia vulgaris Major pollen allergen Art v 1 | CSB-EP774628AOH
- SKU:
- CSB-EP774628AOH
- Availability:
- 3 - 7 Working Days
Description
Recombinant Artemisia vulgaris Major pollen allergen Art v 1 | CSB-EP774628AOH | Cusabio
Alternative Name(s): Defensin-like protein 1 Allergen: Art v 1
Gene Names: N/A
Research Areas: Others
Organism: Artemisia vulgaris (Mugwort)
AA Sequence: AGSKLCEKTSKTYSGKCDNKKCDKKCIEWEKAQHGACHKREAGKESCFCYFDCSKSPPGATPAPPGAAPPPAAGGSPSPPADGGSPPPPADGGSPPVDGGSPPPPSTH
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
Expression Region: 25-132aa
Sequence Info: Full Length of Mature Protein
MW: 26.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "Art v 1, the major allergen of mugwort pollen, is a modular glycoprotein with a defensin-like and a hydroxyproline-rich domain."Himly M., Jahn-Schmid B., Dedic A., Kelemen P., Wopfner N., Altmann F., van Ree R., Briza P., Richter K., Ebner C., Ferreira F.FASEB J. 17:106-108(2003)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted
Protein Families: DEFL family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q84ZX5
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A