Recombinant Arabidopsis thaliana Sucrose-phosphate synthase 1 (SPS1), partial | CSB-EP856727DOA

(No reviews yet) Write a Review
SKU:
CSB-EP856727DOA
Availability:
13 - 23 Working Days
  • Recombinant Arabidopsis thaliana Sucrose-phosphate synthase 1 (SPS1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Arabidopsis thaliana Sucrose-phosphate synthase 1 (SPS1), partial | CSB-EP856727DOA | Cusabio

Alternative Name(s): Sucrose-phosphate synthase 1F Short name: AtSPS1F Sucrose-phosphate synthase 5.1 Short name: AtSPS5.1 UDP-glucose-fructose-phosphate glucosyltransferase

Gene Names: SPS1

Research Areas: Signal Transduction

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: VVIALDFDGEEDTLEATKRILDAVEKERAEGSVGFILSTSLTISEVQSFLVSGGLNPNDFDAFICNSGSDLHYTSLNNEDGPFVVDFYYHSHIEYRWGGEGLRKTLIRWASSLNEKKADNDEQIVTLAEHLSTDYCYTFTVKKPAAVPPVRELRKLLRIQALRCHVVYSQNGTRINVIPVLASRIQALRYLFVRWGIDMAKMAVFVGESGDTDYEGLLGGLHKSVVLK

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 768-995aa

Sequence Info: Partial

MW: 41.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation. Required for nectar secretion.

Reference: "Sequence and analysis of chromosome 5 of the plant Arabidopsis thaliana."Tabata S., Kaneko T., Nakamura Y., Kotani H., Kato T., Asamizu E., Miyajima N., Sasamoto S., Kimura T., Hosouchi T., Kawashima K., Kohara M., Matsumoto M., Matsuno A., Muraki A., Nakayama S., Nakazaki N., Naruo K. Fransz P.F.Nature 408:823-826(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a major role in photosynthetic sucrose synthesis by catalyzing the rate-limiting step of sucrose biosynthesis from UDP-glucose and fructose- 6-phosphate. Involved in the regulation of carbon partitioning in the leaves of plants. May regulate the synthesis of sucrose and therefore play a major role as a limiting factor in the export of photoassimilates out of the leaf. Plays a role for sucrose availability that is essential for plant growth and fiber elongation. Required for nectar secretion.

Involvement in disease:

Subcellular Location:

Protein Families: Glycosyltransferase 1 family

Tissue Specificity: Expressed in seeds, stems, rosette leaves, flowers and siliques. Highly expressed in maturing nectaries.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q94BT0

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose