Recombinant Arabidopsis thaliana Putative defensin-like protein 70 (LCR83) | CSB-YP306814DOA

Recombinant Arabidopsis thaliana Putative defensin-like protein 70 (LCR83) | CSB-YP306814DOA | Cusabio

Alternative Name(s): Putative low-molecular-weight cysteine-rich protein 83 Short name: Protein LCR83

Gene Names: LCR83

Research Areas: Others

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT

Source: Yeast

Tag Info: N-terminal GST-tagged

Expression Region: 28-82aa

Sequence Info: Full Length of Mature Protein

MW: 32.9 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Genome organization of more than 300 defensin-like genes in Arabidopsis."Silverstein K.A.T., Graham M.A., Paape T.D., VandenBosch K.A. Plant Physiol. 138:600-610(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families: DEFL family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P82792

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A