Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A) | CSB-EP522272DOA

(No reviews yet) Write a Review
SKU:
CSB-EP522272DOA
Availability:
3 - 7 Working Days
  • Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Arabidopsis thaliana Polyadenylate-binding protein RBP47A (RBP47A) | CSB-EP522272DOA | Cusabio

Alternative Name(s): RNA-binding protein 47A

Gene Names: RBP47A

Research Areas: Others

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: MQTPNNNGSTDSVLPPTSAGTTPPPPLQQSTPPPQQQQQQQWQQQQQWMAAMQQYPAAAMAMMQQQQMMMYPHPQYAPYNQAAYQQHPQFQYAAYQQQQQQHHQSQQQPRGGSGGDDVKTLWVGDLLHWMDETYLHTCFSHTNEVSSVKVIRNKQTCQSEGYGFVEFLSRSAAEEALQSFSGVTMPNAEQPFRLNWASFSTGEKRASENGPDLSIFVGDLAPDVSDAVLLETFAGRYPSVKGAKVVIDSNTGRSKGYGFVRFGDENERSRAMTEMNGAFCSSRQMRVGIATPKRAAAYGQQNGSQALTLAGGHGGNGSMSDGESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGKGCGFVQFANRQSAEEAIGNLNGTVIGKNTVRLSWGRSPNKQWRSDSGNQWNGGYSRGQGYNNGYANQDSNMYATAAAAVPGAS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-445aa

Sequence Info: Full Length

MW: 53.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.

Reference: "RBP45 and RBP47, two oligouridylate-specific hnRNP-like proteins interacting with poly(A)+ RNA in nuclei of plant cells." Lorkovic Z.J., Wieczorek Kirk D.A., Klahre U., Hemmings-Mieszczak M., Filipowicz W. RNA 6:1610-1624(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.

Involvement in disease:

Subcellular Location: Nucleus, Cytoplasmic granule

Protein Families: Polyadenylate-binding RBP47 family

Tissue Specificity: Expressed in leaves, stems, flowers, and seedlings.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: F4I3B3

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose