Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7) | CSB-EP604499DOAa2

(No reviews yet) Write a Review
SKU:
CSB-EP604499DOAa2
Availability:
3 - 7 Working Days
  • Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7) | CSB-EP604499DOAa2 | Cusabio

Alternative Name(s): Cysteine-rich repeat secretory protein 60

Gene Names: PDLP7

Research Areas: Others

Organism: Arabidopsis thaliana(Mouse-ear cress)

AA Sequence: TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCSRGGDFSILHSFTLI

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 31-298aa

Sequence Info: Full Length of Mature Protein

MW: 41.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Modulates cell-to-cell trafficking.

Reference: "Structural analysis of Arabidopsis thaliana chromosome 5. IX. Sequence features of the regions of 1,011,550 bp covered by seventeen P1 and TAC clones." Kaneko T., Katoh T., Sato S., Nakamura Y., Asamizu E., Kotani H., Miyajima N., Tabata S. DNA Res. 6:183-195(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q0WPN8

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose