Cusabio Arabidopsis thaliana Recombinants
Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3 (NFYA3) | CSB-EP856683DOA
- SKU:
- CSB-EP856683DOA
- Availability:
- 13 - 23 Working Days
Description
Recombinant Arabidopsis thaliana Nuclear transcription factor Y subunit A-3 (NFYA3) | CSB-EP856683DOA | Cusabio
Alternative Name(s): Transcriptional activator HAP2;C
Gene Names: NFYA3
Research Areas: Others
Organism: Arabidopsis thaliana (Mouse-ear cress)
AA Sequence: MMHQMLNKKDSATHSTLPYLNTSISWGVVPTDSVANRRGSAESLSLKVDSRPGHIQTTKQISFQDQDSSSTQSTGQSYTEVASSGDDNPSRQISFSAKSGSEITQRKGFASNPKQGSMTGFPNIHFAPAQANFSFHYADPHYGGLLAATYLPQAPTCNPQMVSMIPGRVPLPAELTETDPVFVNAKQYHAIMRRRQQRAKLEAQNKLIRARKPYLHESRHVHALKRPRGSGGRFLNTKKLLQESEQAAAREQEQDKLGQQVNRKTNMSRFEAHMLQNNKDRSSTTSGSDITSVSDGADIFGHTEFQFSGFPTPINRAMLVHGQSNDMHGGGDMHHFSVHI
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-340aa
Sequence Info: Full Length
MW: 41.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Reference: Multiple genes encoding the conserved CCAAT-box transcription factor complex are expressed in Arabidopsis.Edwards D., Murray J.A.H., Smith A.G.Plant Physiol. 117:1015-1022(1998)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Involvement in disease:
Subcellular Location: Nucleus
Protein Families: NFYA/HAP2 subunit family
Tissue Specificity: Ubiquitous.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q93ZH2
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A