Recombinant Arabidopsis thaliana Lycopene beta cyclase, chloroplastic (LCY1) | CSB-EP657129DOA

(No reviews yet) Write a Review
SKU:
CSB-EP657129DOA
Availability:
13 - 23 Working Days
  • Recombinant Arabidopsis thaliana Lycopene beta cyclase, chloroplastic (LCY1)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Arabidopsis thaliana Lycopene beta cyclase, chloroplastic (LCY1) | CSB-EP657129DOA | Cusabio

Alternative Name(s): LCY1; LCYB; LYC; SZL1; At3g10230; F14P13.17Lycopene beta cyclase; chloroplastic; EC 5.5.1.19; AtLCY; Protein SUPPRESSOR OF ZEAXANTHIN-LESS 1

Gene Names: LCY1

Research Areas: Others

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: QVVDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLLDCLDTTWSGAVVYVDEGVKKDLSRPYGRVNRKQLKSKMLQKCITNGVKFHQSKVTNVVHEEANSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGIVAEVDGHPFDVDKMVFMDWRDKHLDSYPELKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLRMEDIQERMAARLKHLGINVKRIEEDERCVIPMGGPLPVLPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGSPSSNSLRGDQLSAEVWRDLWPIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLQPHYWHGFLSSRLFLPELLVFGLSLFSHASNTSRLEIMTKGTVPLAKMINNLVQDRD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 81-501aa

Sequence Info: Full Length of Mature Protein

MW: 63.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Catalyzes the double cyclization reaction which converts lycopene to beta-carotene and neurosporene to beta-zeacarotene.

Reference: Functional analysis of the beta and epsilon lycopene cyclase enzymes of Arabidopsis reveals a mechanism for control of cyclic carotenoid formation.Cunningham F.X. Jr., Pogson B., Sun Z., McDonald K.A., Dellapenna D., Gantt E.Plant Cell 8:1613-1626(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Involved in carotenoid biosynthesis. Catalyzes the double cyclization reaction which converts lycopene to beta-carotene and neurosporene to beta-zeacarotene

Involvement in disease:

Subcellular Location: Plastid, chloroplast

Protein Families: Lycopene cyclase family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q38933

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose