Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial | CSB-EP636979DOA1

(No reviews yet) Write a Review
SKU:
CSB-EP636979DOA1
Availability:
3 - 7 Working Days
  • Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$422.40 - $2,042.40

Description

Recombinant Arabidopsis thaliana L-ascorbate peroxidase 2, cytosolic (APX2), partial | CSB-EP636979DOA1 | Cusabio

Alternative Name(s): L-ascorbate peroxidase 1b ;APX1b ;AtAPx02

Gene Names: APX2

Research Areas: Others

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: KSYPEVKEEYKKAVQRCKRKLRGLIAEKHCAPIVLRLAWHSAGTFDVKTKTGGPFGTIRHPQELAHDANNGLDIAVRLLDPIKELFPILSYADFYQLAGVVAVEITGGPEIPFHPGRLDKVEPPPEGRLPQATKGVDHLRDVFGRMGLNDKDIVALSGGHTLGRCHKERSGFEGAWTPNPLIFDNSYFKEILSGEKEGLLQLPTDKALLDDPLFLPFVEKYAADEDAFFEDYTEAHLKLSELGFADK

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 4-250aa

Sequence Info: Partial

MW: 31.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Plays a key role in hydrogen peroxide roval.

Reference: Cytosolic ascorbate peroxidase from Arabidopsis thaliana L. is encoded by a small multigene family.Santos M., Gosseau H., Lister C., Foyer C., Creissen G.P., Mullineaux P.M.Planta 198:64-69(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Plays a key role in hydrogen peroxide removal.

Involvement in disease:

Subcellular Location: Cytoplasm

Protein Families: Peroxidase family, Ascorbate peroxidase subfamily

Tissue Specificity: Detected in bundle sheath cells, the photosynthetic cells that surround the phloem and xylem.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q1PER6

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose