Cusabio Arabidopsis thaliana Recombinants
Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9) | CSB-EP879855DOA
- SKU:
- CSB-EP879855DOA
- Availability:
- 3 - 7 Working Days
Description
Recombinant Arabidopsis thaliana EPIDERMAL PATTERNING FACTOR-like protein 9 (EPFL9) | CSB-EP879855DOA | Cusabio
Alternative Name(s): EPF-like protein 9 (EPFL9) (STOMAGEN) (At4g12970) (F25G13.60)
Gene Names: EPFL9
Research Areas: Cardiovascular
Organism: Arabidopsis thaliana (Mouse-ear cress)
AA Sequence: SRPRSIENTVSLLPQVHLLNSRRRHMIGSTAPTCTYNECRGCRYKCRAEQVPVEGNDPINSAYHYRCVCHR
Source: E.coli
Tag Info: N-terminal 10xHis-tagged
Expression Region: 32-102aa
Sequence Info: Full Length of Mature Protein
MW: 14.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Stomagen: Positively regulates stomatal density and patterning. Acts by competing with EPF2 for the same receptors, ERECTA and TMM . Not cleaved by the protease CRSP .
Reference: "Araport11: a complete reannotation of the Arabidopsis thaliana reference genome." Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S., Town C.D. Plant J. 89:789-804(2017)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9SV72
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A