Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5 (DRB5) | CSB-YP815439DOA

(No reviews yet) Write a Review
SKU:
CSB-YP815439DOA
Availability:
25 - 35 Working Days
  • Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5 (DRB5)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£306.40 - £1,076.00

Description

Recombinant Arabidopsis thaliana Double-stranded RNA-binding protein 5 (DRB5) | CSB-YP815439DOA | Cusabio

Alternative Name(s): dsRNA-binding protein 5 Short name: AtDRB5

Gene Names: DRB5

Research Areas: Immunology

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-393aa

Sequence Info: Full Length

MW: 45.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds double-stranded RNA. May be involved in RNA-mediated silencing.

Reference: "Structural analysis of Arabidopsis thaliana chromosome 5. IV. Sequence features of the regions of 1,456,315 bp covered by nineteen physically assigned P1 and TAC clones."Sato S., Kaneko T., Kotani H., Nakamura Y., Asamizu E., Miyajima N., Tabata S.DNA Res. 5:41-54(1998)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds double-stranded RNA. May be involved in RNA-mediated silencing.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: Expressed in the shoot apical meristem (SAM).

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q8GY79

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose