Recombinant Arabidopsis thaliana Dehydrin Xero 1 (XERO1) | CSB-EP338701DOA

(No reviews yet) Write a Review
SKU:
CSB-EP338701DOA
Availability:
13 - 23 Working Days
$422.40 - $2,042.40

Description

Recombinant Arabidopsis thaliana Dehydrin Xero 1 (XERO1) | CSB-EP338701DOA | Cusabio

Alternative Name(s): DHNX

Gene Names: XERO1

Research Areas: Others

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: MESYQNQSGAQQTHQQLDQFGNPFPATTGAYGTAGGAPAVAEGGGLSGMLHRSGSSSSSSSEDDGLGGRRRKKKGITEKIKEKLPGHHDSNKTSSLGSTTTAYDTGTVHHEKKGMMEKIKEKLPGGHH

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-128aa

Sequence Info: Full Length

MW: 17.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "When defense pathways collide. The response of Arabidopsis to a combination of drought and heat stress." Rizhsky L., Liang H., Shuman J., Shulaev V., Davletova S., Mittler R. Plant Physiol. 134:1683-1696(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P25863

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose