Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial | CSB-RP134794Pl

(No reviews yet) Write a Review
SKU:
CSB-RP134794Pl
Availability:
13 - 23 Working Days
  • Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Arabidopsis thaliana Chorismate mutase, chloroplastic (CM1), partial | CSB-RP134794Pl | Cusabio

Alternative Name(s): CM-1

Gene Names: APX1

Research Areas: Cardiovascular

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: ASLLMRSSCCSSAIGGFFDHRRELSTSTPISTLLPLPSTKSSFSVRCSLPQPSKPRSGTSSVHAVMTLAGSLTGKKRVDESESLTLEGIRNSLIRQEDSIIFGLLERAKYCYNADTYDPTAFDMDGFNGSLVEYMVKGTEKLHAKVGRFKSPDEHPFFPDDLPEPMLPPLQYPKVLHFAADSININKKIWNMYFRDLVPRLVKKGDDGNYGSTAVCDAICLQCLSKRIHYGKFVAEAKFQASPEA

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 3-247aa

Sequence Info: Partial

MW: 31.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role in chloroplast biogenesis.Curated

Reference: Identification, characterization and comparative analysis of a novel chorismate mutase gene in Arabidopsis thaliana.Mobley E.M., Kunkel B.N., Keith B.Gene 240:115-123(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in chloroplast biogenesis.

Involvement in disease:

Subcellular Location: Plastid, chloroplast

Protein Families:

Tissue Specificity: Expressed in roots, shoots, rosette leaves, stems, cauline leaves, flowers and siliques.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P42738

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose