null

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1) , partial | CSB-YP878501DOA

(No reviews yet) Write a Review
SKU:
CSB-YP878501DOA
Availability:
25 - 35 Working Days
$459.60 - $1,614.00
Frequently bought together:

Description

Recombinant Arabidopsis thaliana Beta-amylase 1, chloroplastic (BAM1) , partial | CSB-YP878501DOA | Cusabio

Alternative Name(s): 1,4-alpha-D-glucan maltohydrolase () () () () () () () Beta-amylase 7 Thioredoxin-regulated beta-amylase Short name: TR-BAMY BMY7, TRBAMY

Gene Names: BAM1

Research Areas: Others

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 42-354aa

Sequence Info: Partial

MW: 36.3

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Beta-amylase activity. Can use p-nitrophenyl maltopentaoside (PNPG5) as substrate only in reduced form. Can play a minor role in the starch degradation and maltose metabolism in chloroplasts during the night. More active on phosphorylated glucan. Interacts directly with starch or other alpha-1,4-glucan.

Reference:

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9LIR6

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose