Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17) | CSB-EP308638DOA

(No reviews yet) Write a Review
SKU:
CSB-EP308638DOA
Availability:
3 - 7 Working Days
£281.60 - £1,361.60

Description

Recombinant Arabidopsis thaliana Auxin-responsive protein IAA17 (IAA17) | CSB-EP308638DOA | Cusabio

Alternative Name(s): Auxin response 3 (Indoleacetic acid-induced protein 17) (AXR3)

Gene Names: IAA17

Research Areas: Cell Biology

Organism: Arabidopsis thaliana (Mouse-ear cress)

AA Sequence: MMGSVELNLRETELCLGLPGGDTVAPVTGNKRGFSETVDLKLNLNNEPANKEGSTTHDVVTFDSKEKSACPKDPAKPPAKAQVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNALSNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKRLRLMKGSDAIGLAPRAMEKCKSRA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-229aa

Sequence Info: Full Length

MW: 32.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors, proteins that bind to the auxin-responsive promoter element. Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.

Reference: "Functional genomic analysis of the AUXIN/INDOLE-3-ACETIC ACID gene family members in Arabidopsis thaliana." Overvoorde P.J., Okushima Y., Alonso J.M., Chan A., Chang C., Ecker J.R., Hughes B., Liu A., Onodera C., Quach H., Smith A., Yu G., Theologis A. Plant Cell 17:3282-3300(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Aux/IAA proteins are short-lived transcriptional factors that function as repressors of early auxin response genes at low auxin concentrations. Repression is thought to result from the interaction with auxin response factors (ARFs), proteins that bind to the auxin-responsive promoter element (AuxRE). Formation of heterodimers with ARF proteins may alter their ability to modulate early auxin response genes expression.

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: Aux/IAA family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P93830

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose