Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c | CSB-EP344579AMR

(No reviews yet) Write a Review
SKU:
CSB-EP344579AMR
Availability:
13 - 23 Working Days
  • Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£281.60 - £1,361.60

Description

Recombinant Apomastus schlingeri U1-cyrtautoxin-As1c | CSB-EP344579AMR | Cusabio

Alternative Name(s): Aptotoxin VI Aptotoxin-6 Paralytic peptide VI Short name:PP VI

Gene Names: N/A

Research Areas: Others

Organism: Apomastus schlingeri

AA Sequence: EIPQNLGSGIPHDKIKLPNGQWCKTPGDLCSSSSECCKAKHSNSVTYASFCSRQWSGQQALFINQCRTCNVESSMC

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-76aa

Sequence Info: Full Length

MW: 12.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Is both paralytic and lethal, when injected into lepidopteran larvae.

Reference: "Identification of insecticidal peptides from venom of the trap-door spider, Aptostichus schlingeri (Ctenizidae)."Skinner W.S., Dennis P.A., Li J.P., Quistad G.B.Toxicon 30:1043-1050(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Is both paralytic and lethal, when injected into lepidopteran larvae.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Aptotoxin family

Tissue Specificity: Expressed by the venom gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P49270

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose