Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2 | CSB-EP310896DNL

(No reviews yet) Write a Review
SKU:
CSB-EP310896DNL
Availability:
3 - 7 Working Days
  • Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Apium graveolens Major allergen Api g 1, isoallergen 2 | CSB-EP310896DNL | Cusabio

Alternative Name(s): Major allergen Api g 1; isoallergen 2; Allergen Api g 1.0201; allergen Api g 1

Gene Names: N/A

Research Areas: Others

Organism: Apium graveolens (Celery)

AA Sequence: MGVQKTVVEAPSTVSAEKMYQGFLLDMDTVFPKVLPQLIKSVEILEGDGGVGTVKLVHLGEATEYTTMKQKVDVIDKAGLAYTYTTIGGDILVDVLESVVNEFVVVPTDGGCIVKNTTIYNTKGDAVLPEDKIKEATEKSALAFKAVEAYLLANLQFLA

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-159aa

Sequence Info: Full Length

MW: 33.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Characterization of Api g 1.0201, a new member of the Api g 1 family of Celery Allergens.Hoffmann-Sommergruber K., Ferris R., Pec M., Radauer G., O'Riordain G., Camara-Machado O., Scheiner O., Breiteneder H.Int. Arch. Allergy Immunol. 122:115-123(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: BetVI family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P92918

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose