Recombinant Amanita muscaria DOPA 4, 5-dioxygenase (DODA) | CSB-EP310823AZZ

Recombinant Amanita muscaria DOPA 4, 5-dioxygenase (DODA) | CSB-EP310823AZZ | Cusabio

Alternative Name(s): /

Gene Names: DODA

Research Areas: Neuroscience

Organism: Amanita muscaria (Fly agaric)

AA Sequence: MVPSFVVYSSWVNGRQRYIRQAFASILFYIIRDTTLSFPSHTTMSTKPETDLQTVLDSEIKEWHFHIYFHQNNAAEHQAALELRDAVLRLRQDGAFVAVPLFRVNMDPMGPHPVGSYEIWVPSETFASVFSYLCMNRGRLSILVHPLTREELRDHEIRNAWIGPSFPLNLANLPIKSDEIPLQYPSLKLGYSSTAHKMSLEERRKLGDDIEAVLRGEKEAARAPHRDA

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-228aa

Sequence Info: Full Length

MW: 33.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Extradiol dioxygenase that opens up the cyclic ring of DOPA between carbons 4 and 5 thus producing an unstable seco-DOPA that rearranges non-enzymatically to betalamic acid. Can also catalyze the formation of muscaflavin (a pigment found in the hygrocybe mushrooms family and of some amanita species only) by a 2,3-extradiol cleavage of DOPA.

Reference: "The gene coding for the DOPA dioxygenase involved in betalain biosynthesis in Amanita muscaria and its regulation." Hinz U.G., Fivaz J., Girod P.-A., Zryd J.-P. Mol. Gen. Genet. 256:1-6(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P87064

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A