Recombinant Alnus glutinosa Major pollen allergen Aln g 1 | CSB-YP334499AZS

(No reviews yet) Write a Review
SKU:
CSB-YP334499AZS
Availability:
25 - 35 Working Days
  • Recombinant Alnus glutinosa Major pollen allergen Aln g 1
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$459.60 - $1,614.00

Description

Recombinant Alnus glutinosa Major pollen allergen Aln g 1 | CSB-YP334499AZS | Cusabio

Alternative Name(s): Allergen Aln g I Allergen: Aln g 1

Gene Names: N/A

Research Areas: Allergen

Organism: European alder

AA Sequence: GVFNYEAETPSVIPAARLFKAFILDGDKLLPKVAPEAVSSVENIEGNGGPGTIKKITFPEGSPFKYVKERVDEVDRVNFKYSFSVIEGGAVGDALEKVCNEIKIVAAPDGGSILKISNKFHTKGDHEINAEQIKIEKEKAVGLLKAVESYLLAHSDAYN

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-160aa

Sequence Info: Full Length of Mature Protein

MW: 19.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Complementary DNA cloning and expression in Escherichia coli of Aln g I, the major allergen in pollen of alder (Alnus glutinosa)." Breiteneder H., Ferreira F., Reikerstorfer A., Duchene M., Valenta R., Hoffmann-Sommergruber K., Ebner C., Breitenbach M., Kraft D., Scheiner O.J. Allergy Clin. Immunol. 90:909-917(1992)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families: BetVI family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P38948

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose