Recombinant Akkermansia muciniphila Crossover junction endodeoxyribonuclease RuvC (ruvC) | CSB-EP453002AZF

Recombinant Akkermansia muciniphila Crossover junction endodeoxyribonuclease RuvC (ruvC) | CSB-EP453002AZF | Cusabio

Alternative Name(s): Holliday junction nuclease RuvC Holliday junction resolvase RuvC

Gene Names: ruvC

Research Areas: Epigenetics and Nuclear Signaling

Organism: Akkermansia muciniphila (strain ATCC BAA-835 / Muc)

AA Sequence: MRILAIDPAIRNTGYAVVEGDYRRARALDYGTLSIPRSVSQSGCLLAIKQHLGNLIDKWNPDEMAVERIIYVQSHQTAITMGAAKAAVVIAAAEAGLRIMEYSPKSVKLSVVGRGAAQKTQVAFMVRALLELRETPESDAADALAIGLTHLFSADPLKAHMMERKYI

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-167aa

Sequence Info: Full Length

MW: 23.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Reference: "The genome of Akkermansia muciniphila, a dedicated intestinal mucin degrader, and its use in exploring intestinal metagenomes." van Passel M.W., Kant R., Zoetendal E.G., Plugge C.M., Derrien M., Malfatti S.A., Chain P.S., Woyke T., Palva A., de Vos W.M., Smidt H. PLoS ONE 6:E16876-E16876(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.

Involvement in disease:

Subcellular Location:

Protein Families: RuvC family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B2UP63

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A