Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial | CSB-YP322853AYK

(No reviews yet) Write a Review
SKU:
CSB-YP322853AYK
Availability:
3 - 7 Working Days
  • Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial
  • The reducing (R) protein migrates as 55 kDa in SDS-PAGE may be due to glycosylation.
£306.40 - £1,618.40

Description

Recombinant Aggregatibacter actinomycetemcomitans Leukotoxin (ltxA), partial | CSB-YP322853AYK | Cusabio

Alternative Name(s): AaLta lktA

Gene Names: ltxA

Research Areas: Others

Organism: Aggregatibacter actinomycetemcomitans (Actinobacillus actinomycetemcomitans) (Haemophilus actinomycetemcomitans)

AA Sequence: IGSTLRDKFYGSKFNDVFHGHDGDDLIYGYDGDDRLYGDNGNDEIHGGQGNDKLYGGAGNDRLFGEYGNNYLDGGEGDDHLEGGNGSDILRGGSGNDKLFGNQGDDLLDGGEGDDQLAGGEGNDIYVYRKEYGHHTITEHSGDKDKLSLANINLKDVSFERNGNDLLLKTNNRTAVTFKGWFSKPNSSAGLDEYQRKLLEYAPEKDRARLKRQFELQRGKVDKSLNNKVEEIIGKDGERITSQDIDNLFDKSGNKKTISPQELAGLIKNKGKSSSLMSSSRSSSMLTQKSGLSNDISRIISATSGFGSSGKALSASPLQTNNNFNSYANSLATTA

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 721-1055aa

Sequence Info: Partial

MW: 38.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media.

Reference: "Analysis of the Actinobacillus actinomycetemcomitans leukotoxin gene. Delineation of unique features and comparison to homologous toxins." Lally E.T., Golub E.E., Kieba I.R., Taichman N.S., Rosenbloom J., Rosenbloom J.C., Gibson C.W., Demuth D.R. J. Biol. Chem. 264:15451-15456(1989)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Virulence factor that plays an important role in immune evasion. Lyses human lymphocytes and monocytes. Binds to the LFA-1 integrin on the surface of the host cell and to cholesterol-containing membranes, which probably results in large LtxA-LFA-1 clusters in lipid rafts. Shows also beta-hemolytic activity on certain types of growth media.

Involvement in disease:

Subcellular Location: Cell outer membrane, Peripheral membrane protein, Extracellular side, Secreted

Protein Families: RTX prokaryotic toxin (TC 1.C.11) family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16462

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose