Cusabio Virus & Bacteria Recombinants
Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2 (D7) | CSB-YP321587AXQ
- SKU:
- CSB-YP321587AXQ
- Availability:
- 25 - 35 Working Days
Description
Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2 (D7) | CSB-YP321587AXQ | Cusabio
Alternative Name(s): Alternative name(s): Protein D7 Allergen: Aed a 2
Gene Names: D7
Research Areas: Allergen
Organism: Yellowfever mosquito
AA Sequence: STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 18-321aa
Sequence Info: Full Length of Mature Protein
MW: 37.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Thought to be involved in blood-feeding.
Reference: "Isolation and characterization of the gene expressing the major salivary gland protein of the female mosquito, Aedes aegypti."James A.A., Blackmer K., Marinotti O., Ghosn C.R., Racioppi J.V.Mol. Biochem. Parasitol. 44:245-254(1991).
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Thought to be involved in blood-feeding.
Involvement in disease:
Subcellular Location: Secreted
Protein Families:
Tissue Specificity: Expressed in the distal-lateral and medial lobes of the adult female salivary gland.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P18153
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A