Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2 (D7) | CSB-EP321587AXQ

Recombinant Aedes aegypti 37KDA salivary gland allergen Aed a 2 (D7) | CSB-EP321587AXQ | Cusabio

Alternative Name(s): Protein D7 Allergen: Aed a 2

Gene Names: D7

Research Areas: Allergen

Organism: Yellowfever mosquito

AA Sequence: STGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPVDSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPSTNNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYYPAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDTKALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQVYSKPAVQSQVMEIDGKQCPQ

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 18-321aa

Sequence Info: Full Length of Mature Protein

MW: 39.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Thought to be involved in blood-feeding.

Reference: "Isolation and characterization of the gene expressing the major salivary gland protein of the female mosquito, Aedes aegypti."James A.A., Blackmer K., Marinotti O., Ghosn C.R., Racioppi J.V.Mol. Biochem. Parasitol. 44:245-254(1991).

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Thought to be involved in blood-feeding.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Expressed in the distal-lateral and medial lobes of the adult female salivary gland.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P18153

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A