Recombinant Acholeplasma laidlawii Holo-[acyl-carrier-protein] synthase (acpS) | CSB-EP431428ATX

(No reviews yet) Write a Review
SKU:
CSB-EP431428ATX
Availability:
3 - 7 Working Days
$422.40 - $2,042.40

Description

Recombinant Acholeplasma laidlawii Holo-[acyl-carrier-protein] synthase (acpS) | CSB-EP431428ATX | Cusabio

Alternative Name(s): Holo-ACP synthase (4'-phosphopantetheinyl transferase AcpS)

Gene Names: acpS

Research Areas: Cancer

Organism: Acholeplasma laidlawii(strain PG-8A)

AA Sequence: MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1-118aa

Sequence Info: Full Length

MW: 20.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein

Reference: "Complete genome and proteome of Acholeplasma laidlawii." Lazarev V.N., Levitskii S.A., Basovskii Y.I., Chukin M.M., Akopian T.A., Vereshchagin V.V., Kostrjukova E.S., Kovaleva G.Y., Kazanov M.D., Malko D.B., Vitreschak A.G., Sernova N.V., Gelfand M.S., Demina I.A., Serebryakova M.V., Galyamina M.A., Vtyurin N.N., Rogov S.I. Govorun V.M. J. Bacteriol. 193:4943-4953(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A9NHV3

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose