Cusabio Virus & Bacteria Recombinants
Recombinant Acholeplasma laidlawii Holo-[acyl-carrier-protein] synthase (acpS) | CSB-EP431428ATX
- SKU:
- CSB-EP431428ATX
- Availability:
- 3 - 7 Working Days
Description
Recombinant Acholeplasma laidlawii Holo-[acyl-carrier-protein] synthase (acpS) | CSB-EP431428ATX | Cusabio
Alternative Name(s): Holo-ACP synthase (4'-phosphopantetheinyl transferase AcpS)
Gene Names: acpS
Research Areas: Cancer
Organism: Acholeplasma laidlawii(strain PG-8A)
AA Sequence: MIHAIGTDLVELERIKSIGIDRFKDKILNEDEKNEYAKINHENRKLTYLAGRFAVKESLFKCFKAGDKTANYKDFSVLNDSVGAPYVVSKHTSDFVVHITISHTNLYAIAFVVLETKV
Source: E.coli
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-118aa
Sequence Info: Full Length
MW: 20.9 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein
Reference: "Complete genome and proteome of Acholeplasma laidlawii." Lazarev V.N., Levitskii S.A., Basovskii Y.I., Chukin M.M., Akopian T.A., Vereshchagin V.V., Kostrjukova E.S., Kovaleva G.Y., Kazanov M.D., Malko D.B., Vitreschak A.G., Sernova N.V., Gelfand M.S., Demina I.A., Serebryakova M.V., Galyamina M.A., Vtyurin N.N., Rogov S.I. Govorun V.M. J. Bacteriol. 193:4943-4953(2011)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: A9NHV3
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A