Recombinant Abrus precatorius Abrin-a, partial | CSB-EP319970AAC

(No reviews yet) Write a Review
SKU:
CSB-EP319970AAC
Availability:
3 - 7 Working Days
  • Recombinant Abrus precatorius Abrin-a, partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €1,702.00

Description

Recombinant Abrus precatorius Abrin-a, partial | CSB-EP319970AAC | Cusabio

Alternative Name(s): rRNA N-glycosidase

Gene Names: N/A

Research Areas: Others

Organism: Abrus precatorius (Indian licorice) (Glycine abrus)

AA Sequence: QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN

Source: E.coli

Tag Info: N-terminal 10xHis-tagged

Expression Region: 1-251aa

Sequence Info: Partial

MW: 33.6 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin. The B chain is a galactose-specific lectin that facilitates the binding of abrin to the cell membrane that precedes endocytosis.

Reference: "The complete amino acid sequence of the A-chain of abrin-a, a toxic protein from the seeds of Abrus precatorius." Funatsu G., Taguchi Y., Kamenosono M., Yanaka M. Agric. Biol. Chem. 52:1095-1097(1988)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: The A chain is responsible for inhibiting protein synthesis through the catalytic inactivation of 60S ribosomal subunits by removing adenine from position 4,324 of 28S rRNA. Abrin-a is more toxic than ricin.; FUNCTION

Involvement in disease:

Subcellular Location:

Protein Families: Ribosome-inactivating protein family, Type 2 RIP subfamily

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P11140

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose