Recombinan Bombyx mori Cecropin-D (CECD) | CSB-CF524922BTT

Recombinan Bombyx mori Cecropin-D (CECD) | CSB-CF524922BTT | Cusabio

Alternative Name(s): CECDCecropin-D

Gene Names: CECD

Research Areas: Others

Organism: Bombyx mori (Silk moth)

AA Sequence: GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ

Source: in vitro E.coli expression system

Tag Info: N-terminal 6xHis-tagged

Expression Region: 25-60aa

Sequence Info: Full Length of Mature Protein

MW: 7.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Reference: "cDNA cloning and gene expression of cecropin D, an antibacterial protein in the silkworm, Bombyx mori." Yang J., Furukawa S., Sagisaka A., Ishibashi J., Taniai K., Shono T., Yamakawa M. Comp. Biochem. Physiol. 122B:409-414(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Cecropin family

Tissue Specificity: Mainly in fat body. Lower in hemocytes. Not expressed in midguts, malpighian tubules and silk glands.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O76146

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A