E.coli Recombinant

Recombinant Human Protein FAM217A (FAM217A) | CSB-EP809009HU | CusabioAlternative Name(s): C6orf146Gene Names: FAM217AResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial | CSB-EP807451MO1 | CusabioAlternative Name(s): Dock8Dedicator of cytokinesis protein 8Gene Names: Dock8Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Dedicator of cytokinesis protein 8 (Dock8), partial | CSB-EP807451MO | CusabioAlternative Name(s): Dock8Dedicator of cytokinesis protein 8Gene Names: Dock8Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Negative regulator of reactive oxygen species (Nrros), partial | CSB-EP807383MO | CusabioAlternative Name(s): Leucine-rich repeat-containing protein 33 (Negative regulator of reactive oxygen species) (Lrrc33)Gene Names: NrrosResearch...

Recombinant Mouse Histone deacetylase complex subunit SAP130 (Sap130) , partial | CSB-EP807359MO | CusabioAlternative Name(s): 130KDA Sin3-associated polypeptide Sin3-associated polypeptide p130Gene Names: Sap130Research Areas: OthersOrganism: Mus...

Recombinant Mouse cGMP-specific 3, 5-cyclic phosphodiesterase (Pde5a), partial | CSB-EP807017MO | CusabioAlternative Name(s): cGMP-binding cGMP-specific phosphodiesterase (CGB-PDE) (Pde5)Gene Names: Pde5aResearch Areas: CancerOrganism: Mus musculus...

Recombinant Mouse RNA binding protein fox-1 homolog 3 (Rbfox3) | CSB-EP806847MO | CusabioAlternative Name(s): Fox-1 homolog C (Hexaribonucleotide-binding protein 3) (Fox-3) (Neuronal nuclei antigen) (NeuN antigen) (D11Bwg0517e) (Hrnbp3)Gene Names:...

Recombinant Mouse Kallikrein-14 (Klk14) | CSB-EP806542MOa2 | CusabioAlternative Name(s): Glandular kallikrein KLK14Gene Names: Klk14Research Areas: Tags & Cell MarkersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Kallikrein-14 (Klk14) | CSB-EP806542MO | CusabioAlternative Name(s): Glandular kallikrein KLK14Gene Names: Klk14Research Areas: Tags & Cell MarkersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Serine protease inhibitor Kazal-type 2 (Spink2) | CSB-EP806409MO | CusabioAlternative Name(s): Spink2; Serine protease inhibitor Kazal-type 2Gene Names: Spink2Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Vesicular stomatitis Indiana virus RNA-directed RNA polymerase L (L), partial | CSB-EP806333VBE | CusabioAlternative Name(s): Large structural protein Replicase TranscriptaseGene Names: LResearch Areas: OthersOrganism: Vesicular stomatitis...

Recombinant Mouse Sushi domain-containing protein 4 (Susd4), partial | CSB-EP805887MO | CusabioAlternative Name(s): Susd4; Sushi domain-containing protein 4Gene Names: Susd4Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse WD repeat-containing and planar cell polarity effector protein fritz homolog (Wdpcp) | CSB-EP804911MO | CusabioAlternative Name(s): Homolog-13WD repeat-containing and planar cell polarity effector proteinGene Names: WdpcpResearch Areas:...

Recombinant Mouse Carbamoyl-phosphate synthase [ammonia], mitochondrial (Cps1), partial | CSB-EP804448MO | CusabioAlternative Name(s): Carbamoyl-phosphate synthase [ammonia], mitochondrial(EC 6.3.4.16)(Carbamoyl-phosphate synthetase I)(CPSase I)Gene...

Recombinant Mouse Enoyl-CoA hydratase,  mitochondrial (Echs1) (C225S) | CSB-EP804339MO(M) | CusabioAlternative Name(s): Enoyl-CoA hydratase 1 Short-chain enoyl-CoA hydrataseGene Names: Echs1Research Areas: metabolismOrganism: Mus musculus (Mouse)AA...

Recombinant Mouse Enoyl-CoA hydratase, mitochondrial (Echs1) | CSB-EP804339MO | CusabioAlternative Name(s): Enoyl-CoA hydratase 1 (Short-chain enoyl-CoA hydratase) (SCEH)Gene Names: Echs1Research Areas: CancerOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Human metapneumovirus Phosphoprotein (P) | CSB-EP804307HDAM | CusabioAlternative Name(s): Protein PGene Names: PResearch Areas: Signal TransductionOrganism: Human metapneumovirus(strain CAN97-83)(HMPV)AA Sequence:...

Recombinant Mouse Sialidase-4 (Neu4) | CSB-EP803970MO | CusabioAlternative Name(s): N-acetyl-alpha-neuraminidase 4 (Neuraminidase 4)Gene Names: Neu4Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse C-type lectin domain family 4 member G (Clec4g), partial | CSB-EP803912MO | CusabioAlternative Name(s): /Gene Names: Clec4gResearch Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Thioredoxin-interacting protein (Txnip) | CSB-EP803849MO | CusabioAlternative Name(s): Vitamin D3 up-regulated protein 1Gene Names: TxnipResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Pseudomonas syringae pv. tomato Effector protein hopM1 (hopM1) | CSB-EP803414FGP(A4) | CusabioAlternative Name(s): Hrp outer protein M1 (Type III effector HopPtoM) (holPtoX) (hopPtoM)Gene Names: hopM1Research Areas: OthersOrganism:...

Recombinant Human Chromodomain-helicase-DNA-binding protein 1-like (CHD1L), partial | CSB-EP803136HU | CusabioAlternative Name(s): Amplified in liver cancer protein 1Gene Names: CHD1LResearch Areas: Epigenetics and Nuclear Signaling Organism: Homo...

Recombinant Klebsiella oxytoca Carbepenem-hydrolyzing beta-lactamase KPC (bla) | CSB-EP802889KBE | CusabioAlternative Name(s): Carbapenem-hydrolyzing beta-lactamase KPC-2Gene Names: blaResearch Areas: OthersOrganism: Klebsiella oxytocaAA Sequence:...

Recombinant Human Transforming growth factor beta activator LRRC33 (NRROS), partial | CSB-EP801264HU | CusabioAlternative Name(s): Leucine-rich repeat-containing protein 33 LRRC33Gene Names: NRROSResearch Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Human Lipolysis-stimulated lipoprotein receptor (LSR), partial | CSB-EP801252HU | CusabioAlternative Name(s): ILDR3; Immunoglobulin like domain containing receptor 3; Lipolysis Stimulated Lipoprotein Receptor; Lipolysis stimulated remnant;...

Recombinant Human Protein PAT1 homolog 1 (PATL1) | CSB-EP801224HU | CusabioAlternative Name(s): PAT1-like protein 1;Protein PAT1 homolog b;Pat1b;hPat1bGene Names: PATL1Research Areas: Epigenetics and Nuclear SignalingOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Interferon epsilon (Ifne) | CSB-EP800374MO | CusabioAlternative Name(s): Interferon epsilon-1Interferon tau-1Gene Names: IfneResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Mouse Septin-9 (Septin9) | CSB-EP800330MO | CusabioAlternative Name(s): SL3-3 integration site 1 protein Kiaa0991, Sint1Gene Names: Septin9Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Filamin-A-interacting protein 1 (FILIP1), partial | CSB-EP800226HU | CusabioAlternative Name(s): Filamin-A-interacting protein 1; FILIP; FILIP1; FLIP1_HUMANGene Names: FILIP1Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Arabidopsis thaliana GRF1-interacting factor 1 (GIF1) | CSB-EP781430DOA | CusabioAlternative Name(s): GRF1-interacting factor 1(AtGIF1)(Protein ANGUSTIFOLIA 3)(Transcription coactivator GIF1)Gene Names: GIF1Research Areas: Signal...

Recombinant Human B melanoma antigen 2 (BAGE2) | CSB-EP774832HU | CusabioAlternative Name(s): Cancer/testis antigen 2.2Gene Names: BAGE2Research Areas: CancerOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Tripartite motif-containing protein 69 (TRIM69) | CSB-EP774824HU | CusabioAlternative Name(s): RFP-like domain-containing protein trimless RING finger protein 36 Tripartite motif-containing protein 69Gene Names: TRIM69Research Areas:...

Recombinant Artemisia vulgaris Major pollen allergen Art v 1 | CSB-EP774628AOH | CusabioAlternative Name(s): Defensin-like protein 1 Allergen: Art v 1Gene Names: N/AResearch Areas: OthersOrganism: Artemisia vulgaris (Mugwort)AA Sequence:...

Recombinant Androctonus mauretanicus mauretanicus Alpha-toxin Amm8 | CSB-EP773772AKB | CusabioAlternative Name(s): Alpha-anatoxin Amm VIII (Amm VIII) (AmmVIII) (Neurotoxin 8) (P4)Gene Names: N/AResearch Areas: OthersOrganism: Androctonus mauritanicus...

Recombinant Human Sprouty-related, EVH1 domain-containing protein 1 (SPRED1) | CSB-EP773600HU | CusabioAlternative Name(s): EVH1 domain-containing protein 1; EVH1/Sprouty domain containing protein; FLJ33903; hSpred 1; hSpred1; NFLS; PPP1R147; protein...

Recombinant Human Probable ATP-dependent RNA helicase DDX53 (DDX53) | CSB-EP773024HU | CusabioAlternative Name(s): Cancer-associated gene protein Cancer/testis antigen 26 Short name: CT26 DEAD box protein 53 DEAD box protein CAGE CAGEGene Names:...

Recombinant Human papillomavirus type 6a protein E4 (E4) | CSB-EP772797HOM | CusabioAlternative Name(s): /Gene Names: E4Research Areas: OthersOrganism: Human papillomavirus type 6aAA Sequence:...

Recombinant Human Beta-defensin 128 (DEFB128) | CSB-EP772034HU | CusabioAlternative Name(s): Beta-defensin 28 Defensin, beta 128Gene Names: DEFB128Research Areas: ImmunologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial | CSB-EP771253EQVa2 | CusabioAlternative Name(s): Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3Gene Names: LTBResearch Areas: OthersOrganism: Pan troglodytes...

Recombinant Pan troglodytes Lymphotoxin-beta (LTB), partial | CSB-EP771253EQV | CusabioAlternative Name(s): Tumor necrosis factor C ;TNF-CTumor necrosis factor ligand superfamily member 3Gene Names: LTBResearch Areas: OthersOrganism: Pan troglodytes...

Recombinant Bacillus anthracis Single-stranded DNA-binding protein (ssb) | CSB-EP770616BQE | CusabioAlternative Name(s): ssb; ssb-1; BA_5722; GBAA_5722; BAS5326Single-stranded DNA-binding protein; SSBGene Names: ssbResearch Areas: OthersOrganism:...

Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1) | CSB-EP770515MO | CusabioAlternative Name(s): Nmes1Normal mucosa of esophagus-specific gene 1 proteinGene Names: Nmes1Research Areas: OthersOrganism: Mus musculus (Mouse)AA...

Recombinant Mouse Carnosine N-methyltransferase (Carnmt1), partial | CSB-EP770467MO1a2 | CusabioAlternative Name(s): Gene Names: Carnmt1Research Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human Vasohibin-2 (VASH2) | CSB-EP769783HU | CusabioAlternative Name(s): Vasohibin-like proteinGene Names: VASH2Research Areas: CardiovascularOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Shigella flexneri Adenylate kinase (adk) | CSB-EP769467SZB | CusabioAlternative Name(s): ATP-AMP transphosphorylase ATP:AMP phosphotransferase Adenylate monophosphate kinaseGene Names: adkResearch Areas: Signal TransductionOrganism: Shigella...

Recombinant Enterococcus faecalis Gelatinase (gelE) | CSB-EP769310ELW | CusabioAlternative Name(s): CoccolysinGene Names: gelEResearch Areas: OthersOrganism: Enterococcus faecalis (strain ATCC 700802 / V583)AA Sequence:...

Recombinant Mouse Serine/threonine-protein kinase VRK1 (Vrk1) | CSB-EP768902MO | CusabioAlternative Name(s): Serine/threonine-protein kinase 51PK Vaccinia-related kinase 1Gene Names: Vrk1Research Areas: Cell BiologyOrganism: Mus musculus (Mouse)AA...

Recombinant Vesicular stomatitis Indiana virus Protein C' (P) | CSB-EP768100VBH | CusabioAlternative Name(s): PProtein C'Gene Names: pResearch Areas: OthersOrganism: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)AA Sequence:...

Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5) | CSB-EP767382MO | CusabioAlternative Name(s): Thyrostimulin subunit betaGene Names: Gphb5Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Portulaca grandiflora 4, 5-DOPA dioxygenase extradiol (DODA) | CSB-EP767105PIAD | CusabioAlternative Name(s): DODA4,5-DOPA dioxygenase extradiol; EC 1.13.11.29Gene Names: DODAResearch Areas: OthersOrganism: Portulaca grandiflora (Rose moss)AA...

Recombinant Salmo salar Elastase-1 | CSB-EP766453SWI | CusabioAlternative Name(s): Gene Names: N/AResearch Areas: OthersOrganism: Salmo salar (Atlantic salmon)AA Sequence:...

Recombinant Mycobacterium tuberculosis Methionine aminopeptidase 1 (map-1) | CSB-EP765906MVZ | CusabioAlternative Name(s): Peptidase M (MAP 1) (MetAP 1) (mapA)Gene Names: map-1Research Areas: Signal TransductionOrganism: Mycobacterium tuberculosis...

Recombinant Mouse Thymosin beta-10 (Tmsb10) | CSB-EP765096MO | CusabioAlternative Name(s): Tmsb10;Ptmb10Gene Names: Tmsb10Research Areas: Signal TransductionOrganism: Mus musculus (Mouse)AA Sequence: ADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEISSource: E...

Recombinant Zaire ebolavirus Polymerase cofactor VP35 (VP35) | CSB-EP764950ZAT | CusabioAlternative Name(s): Ebola VP35; eVP35Gene Names: VP35Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA Sequence:...

Recombinant Zaire ebolavirus RNA-directed RNA polymerase L (L), partial | CSB-EP764949ZAT | CusabioAlternative Name(s): Large structural proteinGene Names: LResearch Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV)AA Sequence:...

Recombinant Human Insulin growth factor-like family member 1 (IGFL1) | CSB-EP764932HU | CusabioAlternative Name(s): IGFL1; UNQ644/PRO1274; Insulin growth factor-like family member 1Gene Names: IGFL1Research Areas: OthersOrganism: Homo sapiens (Human)AA...

Recombinant Mouse Toll-like receptor 11 (Tlr11), partial | CSB-EP764846MO | CusabioAlternative Name(s): Toll-like receptor 12Gene Names: Tlr11Research Areas: ImmunologyOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Staphylococcus aureus ESAT-6 secretion system extracellular protein A (esxA) | CSB-EP763968SKW | CusabioAlternative Name(s): esxA; SAS0258Type VII secretion system extracellular protein A; Ess extracellular protein AGene Names: esxAResearch...

Recombinant Staphylococcus aureus Iron-regulated surface determinant protein A (isdA) | CSB-EP763937SKW | CusabioAlternative Name(s): Fur-regulated protein A Staphylococcal transferrin-binding protein A frpA, stbAGene Names: isdAResearch Areas:...

Recombinant Mouse Chemokine-like protein TAFA-1 (Tafa1) | CSB-EP763174MO | CusabioAlternative Name(s): Fam19a1Gene Names: Tafa1Research Areas: Epigenetics and Nuclear SignalingOrganism: Mus musculus(Mouse)AA Sequence:...

Recombinant Vespa mandarinia Vespakinin-M | CSB-EP762592VBR | CusabioAlternative Name(s): Vespakinin-MGene Names: N/AResearch Areas: OthersOrganism: Vespa mandarinia(Asian giant hornet)AA Sequence: GRPPGFSPFRIDSource: E.coliTag Info: N-terminal...

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-EP762349ZATa0 | CusabioAlternative Name(s): Membrane-associated protein VP40Gene Names: VP40Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Zaire ebolavirus Matrix protein VP40 (VP40) | CSB-EP762349ZAT | CusabioAlternative Name(s): Membrane-associated protein VP40Gene Names: VP40Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Acinetobacter baumannii Beta-lactamase (NDM-1), partial | CSB-EP761ABS | CusabioAlternative Name(s): /Gene Names: NDM-1Research Areas: OthersOrganism: Acinetobacter baumanniiAA Sequence:...

Recombinant Human metapneumovirus Matrix protein (M) | CSB-EP761526HDAM | CusabioAlternative Name(s): M; Matrix proteinGene Names: MResearch Areas: Signal TransductionOrganism: Human metapneumovirus (strain CAN97-83) (HMPV)AA Sequence:...

Recombinant Human Complexin-2 (CPLX2) | CSB-EP761369HU | CusabioAlternative Name(s): Complexin IIGene Names: CPLX2Research Areas: OthersOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Uncharacterized aarF domain-containing protein kinase 2 (Adck2), partial | CSB-EP761222MO | CusabioAlternative Name(s): Adck2Uncharacterized aarF domain-containing protein kinase 2; EC 2.7.11.-Gene Names: Adck2Research Areas:...

Recombinant Human Astacin-like metalloendopeptidase (ASTL) | CSB-EP760708HU | CusabioAlternative Name(s): Oocyte astacin (Ovastacin)Gene Names: ASTLResearch Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse C-type lectin domain family 18 member A (Clec18a) | CSB-EP759740MO | CusabioAlternative Name(s): Mannose receptor-like protein (Mrcl) (Mrlp)Gene Names: Clec18aResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Staphylococcus aureus mRNA interferase MazF (mazF) | CSB-EP758890SUL | CusabioAlternative Name(s): Toxin MazF (mRNA interferase MazF)Gene Names: mazFResearch Areas: OthersOrganism: Staphylococcus aureus (strain MW2)AA Sequence:...

Recombinant Listeria monocytogenes serotype 4b Internalin-A (inlA) , partial | CSB-EP758331LAAD | CusabioAlternative Name(s): inlA; LMOf2365_0471; Internalin AGene Names: inlAResearch Areas: OthersOrganism: Listeria monocytogenes serotype 4b (strain...

Recombinant Human Transmembrane protease serine 11A (TMPRSS11A), partial | CSB-EP757932HU | CusabioAlternative Name(s): Airway trypsin-like protease 1;Epidermal type-II transmembrane serine protease;Esophageal cancer-susceptibility gene 1 proteinGene...

Recombinant Human ALK and LTK ligand 1 (ALKAL1) | CSB-EP757795HU | CusabioAlternative Name(s): ALKAL1; FAM150A; UNQ9433/PRO34745ALK and LTK ligand 1; Augmentor beta; AUG-beta; Protein FAM150AGene Names: ALKAL1Research Areas: OthersOrganism: Homo sapiens...

Recombinant Arachis hypogaea Conglutin-7 | CSB-EP757666ANE | CusabioAlternative Name(s): Conglutin-7; 2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2; allergen Ara h 2Gene Names: N/AResearch Areas: OthersOrganism: Arachis hypogaea...

Recombinant Mouse Erythroferrone (Erfe) | CSB-EP757647MO | CusabioAlternative Name(s): Complement C1q tumor necrosis factor-related protein 15 MyonectinGene Names: ErfeResearch Areas: OthersOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Guinea pig Interleukin-23 subunit alpha (IL23A) | CSB-EP757211GU | CusabioAlternative Name(s): Interleukin-23 subunit alpha;IL-23 subunit alpha;IL-23-A;Interleukin-23 subunit p19;IL-23p19Gene Names: IL23AResearch Areas: CancerOrganism: Cavia...

Recombinant Human Ragulator complex protein LAMTOR1 (LAMTOR1) | CSB-EP757083HU | CusabioAlternative Name(s): Late endosomal/lysosomal adaptor and MAPK and MTOR activator 1 Lipid raft adaptor protein p18 Protein associated with DRMs and...

Recombinant Bartonella henselae Lipoyl synthase (lipA) | CSB-EP756700BSG | CusabioAlternative Name(s): Lip-synGene Names: lipAResearch Areas: OthersOrganism: Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) (Rochalimaea henselae)AA...

Recombinant Mouse Secretoglobin family 1C member 1 (Scgb1c1) | CSB-EP755514MO | CusabioAlternative Name(s): Secretoglobin RYD5 (Ryd5)Gene Names: Scgb1c1Research Areas: CancerOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Zaire ebolavirus Minor nucleoprotein VP30 (VP30) | CSB-EP755264ZATa0 | CusabioAlternative Name(s): Transcription activator VP30Gene Names: VP30Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Zaire ebolavirus Minor nucleoprotein VP30 (VP30) | CSB-EP755264ZAT | CusabioAlternative Name(s): Transcription activator VP30Gene Names: VP30Research Areas: OthersOrganism: Zaire ebolavirus (strain Kikwit-95) (ZEBOV) (Zaire Ebola virus)AA...

Recombinant Varicella-zoster virus Envelope glycoprotein H (gH), partial | CSB-EP755262VAQ | CusabioAlternative Name(s): /Gene Names: gHResearch Areas: Signal TransductionOrganism: Varicella-zoster virus (strain Oka vaccine) (HHV-3) (Human herpesvirus...

Recombinant Human Placenta-expressed transcript 1 protein (PLET1) | CSB-EP754399HU | CusabioAlternative Name(s): C11orf34Gene Names: PLET1Research Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Mouse Pancreatic triacylglycerol lipase (Pnlip) | CSB-EP754214MO | CusabioAlternative Name(s): PL Short name: PTL Short name: Pancreatic lipaseGene Names: PnlipResearch Areas: CardiovascularOrganism: Mus musculus (Mouse)AA Sequence:...

Recombinant Human COP9 signalosome complex subunit 2 (COPS2) | CSB-EP753713HUe1 | CusabioAlternative Name(s): Alien homolog JAB1-containing signalosome subunit 2 Thyroid receptor-interacting protein 15Gene Names: COPS2Research Areas: Signal...

Recombinant Human COP9 signalosome complex subunit 2 (COPS2) | CSB-EP753713HU | CusabioAlternative Name(s): Alien homologGene Names: COPS2Research Areas: Signal TransductionOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Danio rerio COP9 signalosome complex subunit 2 (cops2) | CSB-EP753713DIL | CusabioAlternative Name(s): csn2Gene Names: cops2Research Areas: Signal TransductionOrganism: Danio rerio (Zebrafish) (Brachydanio rerio)AA Sequence:...

Recombinant Human Tau-tubulin kinase 2 (TTBK2), partial | CSB-EP753711HU | CusabioAlternative Name(s): KIAA0847Gene Names: TTBK2Research Areas: NeuroscienceOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human Isthmin-2 (ISM2), partial | CSB-EP753615HU1 | CusabioAlternative Name(s): Thrombospondin and AMOP domain-containing isthmin-like protein 1 (Thrombospondin type-1 domain-containing protein 3)Gene Names: ISM2Research Areas:...

Recombinant Human Isthmin-2 (ISM2) | CSB-EP753615HU | CusabioAlternative Name(s): Thrombospondin and AMOP domain-containing isthmin-like protein 1 Thrombospondin type-1 domain-containing protein 3Gene Names: ISM2Research Areas: othersOrganism: Homo...

Recombinant Staphylococcus aureus Clumping factor B (clfB) , partial | CSB-EP753442SKV | CusabioAlternative Name(s): Fibrinogen receptor B Fibrinogen-binding protein BGene Names: clfBResearch Areas: OthersOrganism: Staphylococcus aureus (strain...

Recombinant Staphylococcus aureus Clumping factor A?clfA), partial | CSB-EP753416SKWe1 | CusabioAlternative Name(s): Fibrinogen receptor A Fibrinogen-binding protein AGene Names: clfAResearch Areas: MicrobiologyOrganism: Staphylococcus aureus (strain...

Recombinant Staphylococcus aureus Clumping factor A (clfA), partial | CSB-EP753416SKW | CusabioAlternative Name(s): Fibrinogen receptor A Fibrinogen-binding protein AGene Names: clfAResearch Areas: MicrobiologyOrganism: Staphylococcus aureus (strain...

Recombinant Chamaecyparis obtusa Polygalacturonase | CSB-EP752116CHAX | CusabioAlternative Name(s): Polygalacturonase; PG; EC 3.2.1.15; Major pollen allergen Cha o 2; Pectinase; allergen Cha o 2Gene Names: N/AResearch Areas: OthersOrganism: Chamaecyparis...

Recombinant Staphylococcus aureus Gamma-hemolysin component C (hlgC) | CSB-EP751944SKYa0 | CusabioAlternative Name(s): hlgC; SA2208Gamma-hemolysin component CGene Names: hlgCResearch Areas: MicrobiologyOrganism: Staphylococcus aureus (strain N315)AA...

Recombinant Staphylococcus aureus Gamma-hemolysin component C (hlgC) | CSB-EP751944SKY | CusabioAlternative Name(s): hlgC; SA2208Gamma-hemolysin component CGene Names: hlgCResearch Areas: MicrobiologyOrganism: Staphylococcus aureus (strain N315)AA...

Recombinant Human metapneumovirus Nucleoprotein (N) | CSB-EP751042HDAM | CusabioAlternative Name(s): Nucleocapsid protein (Protein N)Gene Names: NResearch Areas: Signal TransductionOrganism: Human metapneumovirus(strain CAN97-83)(HMPV)AA Sequence:...

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial | CSB-EP751020HUb1 | CusabioAlternative Name(s): C6orf144Gene Names: GFRALResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...

Recombinant Human GDNF family receptor alpha-like (GFRAL), partial | CSB-EP751020HU | CusabioAlternative Name(s): bA360D14.1; C6orf144; GDNF family receptor alpha-like; Gfral; GFRAL_HUMAN; GRAL; IVFI9356; UNQ9356; UNQ9356/PRO34128Gene Names:...

Recombinant Human Methyltransferase-like protein 7B (METTL7B) | CSB-EP751014HU | CusabioAlternative Name(s): /Gene Names: METTL7BResearch Areas: Cell BiologyOrganism: Homo sapiens (Human)AA Sequence:...