Cusabio Xenopus laevis Recombinants
Recombinant Xenopus laevis Transforming growth factor beta-1 (TGFB1) | CSB-YP023446XBE
- SKU:
- CSB-YP023446XBE
- Availability:
- 25 - 35 Working Days
Description
Recombinant Xenopus laevis Transforming growth factor beta-1 (TGFB1) | CSB-YP023446XBE | Cusabio
Alternative Name(s): TGF-beta-5
Gene Names: TGFB1
Research Areas: Signal Transduction
Organism: Xenopus laevis (African clawed frog)
AA Sequence: GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 271-382aa
Sequence Info: Full Length of Mature Protein
MW: 14.6 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Important role in certain aspects of differentiation.
Reference: "Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis."Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.J. Biol. Chem. 265:1089-1093(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Important role in certain aspects of differentiation.
Involvement in disease:
Subcellular Location: Secreted
Protein Families: TGF-beta family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P16176
HGNC Database Link: N/A
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: N/A
OMIM Database Link: N/A