Recombinant Xenopus laevis Transforming growth factor beta-1 (tgfb1) | CSB-EP023446XBE

Recombinant Xenopus laevis Transforming growth factor beta-1 (tgfb1) | CSB-EP023446XBE | Cusabio

Alternative Name(s): Short name: TGF-beta-1 Alternative name(s): TGF-beta-5

Gene Names: tgfb1

Research Areas: Signal Transduction

Organism: Xenopus laevis (African clawed frog)

AA Sequence: GVGQEYCFGNNGPNCCVKPLYINFRKDLGWKWIHEPKGYEANYCLGNCPYIWSMDTQYSKVLSLYNQNNPGASISPCCVPDVLEPLPIIYYVGRTAKVEQLSNMVVRSCNCS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 271-382aa

Sequence Info: Full Length of Mature Protein

MW: 28.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Important role in certain aspects of differentiation.

Reference: "Identification of a novel transforming growth factor-beta (TGF-beta 5) mRNA in Xenopus laevis."Kondaiah P., Sands M.J., Smith J.M., Fields A., Roberts A.B., Sporn M.B., Melton D.A.J. Biol. Chem. 265:1089-1093(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Important role in certain aspects of differentiation.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: TGF-beta family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16176

HGNC Database Link: N/A

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A