Recombinant Vaccinia virus Protein L1 (VACWR088), partial | CSB-YP362178VAI1

Recombinant Vaccinia virus Protein L1 (VACWR088), partial | CSB-YP362178VAI1 | Cusabio

Alternative Name(s): Virion membrane protein M25

Gene Names: VACWR088

Research Areas: Others

Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

AA Sequence: GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 2-183aa

Sequence Info: Partial

MW: 21.3 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex. Needed for fusion and penetration of the virus core into host cell.

Reference: "Use of a cell-free system to identify the vaccinia virus L1R gene product as the major late myristylated virion protein M25." Franke C.A., Wilson E.M., Hruby D.E. J. Virol. 64:5988-5996(1990)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P07612

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A