Cusabio Vaccinia virus Recombinants
Recombinant Vaccinia virus Protein L1 (VACWR088), partial | CSB-YP362178VAI1
- SKU:
 - CSB-YP362178VAI1
 - Availability:
 - 3 - 7 Working Days
 
Description
Recombinant Vaccinia virus Protein L1 (VACWR088), partial | CSB-YP362178VAI1 | Cusabio
Alternative Name(s): Virion membrane protein M25
Gene Names: VACWR088
Research Areas: Others
Organism: Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
AA Sequence: GAAASIQTTVNTLSERISSKLEQEANASAQTKCDIEIGNFYIRQNHGCNLTVKNMCSADADAQLDAVLSAATETYSGLTPEQKAYVPAMFTAALNIQTSVNTVVRDFENYVKQTCNSSAVVDNKLKIQNVIIDECYGAPGSPTNLEFINTGSSKGNCAIKALMQLTTKATTQIAPKQVAGTG
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 2-183aa
Sequence Info: Partial
MW: 21.3 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Envelope protein which probably plays a role in virus entry into the host cell. Is probably involved in the virus attachment to the host cell surface and associates with the entry/fusion complex. Needed for fusion and penetration of the virus core into host cell.
Reference: "Use of a cell-free system to identify the vaccinia virus L1R gene product as the major late myristylated virion protein M25." Franke C.A., Wilson E.M., Hruby D.E. J. Virol. 64:5988-5996(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P07612
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A