Recombinant Ustilago maydis P6 virus KP6 killer toxin, partial | CSB-EP325875UBC

Recombinant Ustilago maydis P6 virus KP6 killer toxin, partial | CSB-EP325875UBC | Cusabio

Alternative Name(s): KP6 killer toxin; Killer protein 6) [Cleaved into: KP6 killer toxin subunit alpha; VP10); KP6 killer toxin subunit beta; VP12.5)]

Gene Names: N/A

Research Areas: Others

Organism: Ustilago maydis P6 virus (UmV6) (UmV-P6)

AA Sequence: NNAFCAGFGLSCKWECWCTAHGTGNELRYATAAGCGDHLSKSYYDARAGHCLFSDDLRNQFYSHCSSLNNNMSCRSLS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 28-105aa

Sequence Info: Partial

MW: 24.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death.

Reference: Structure of Ustilago maydis killer toxin KP6 alpha-subunit. A multimeric assembly with a central pore.Li N., Erman M., Pangborn W., Duax W.L., Park C.M., Bruenn J., Ghosh D.J. Biol. Chem. 274:20425-20431(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This protein is lethal to sensitive cells of the same or related species. The KP6 alpha subunit is known to recognize some cellular receptors before interaction of the complex with KP6 beta, precipitating cell death.

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P16948

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A