Cusabio Virus & Bacteria Recombinants
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin | CSB-YP357829TIF
- SKU:
- CSB-YP357829TIF
- Availability:
- 25 - 35 Working Days
Description
Recombinant Trichosanthes kirilowii Ribosome-inactivating protein alpha-trichosanthin | CSB-YP357829TIF | Cusabio
Alternative Name(s): rRNA N-glycosidase
Gene Names: N/A
Research Areas: Others
Organism: Trichosanthes kirilowii (Chinese snake gourd) (Chinese cucumber)
AA Sequence: DVSFRLSGATSSSYGVFISNLRKALPNERKLYDIPLLRSSLPGSQRYALIHLTNYADETISVAIDVTNVYIMGYRAGDTSYFFNEASATEAAKYVFKDAMRKVTLPYSGNYERLQTAAGKIRENIPLGLPALDSAITTLFYYNANSAASALMVLIQSTSEAARYKFIEQQIGKRVDKTFLPSLAIISLENSWSALSKQIQIASTNNGQFESPVVLINAQNQRVTITNVDAGVVTSNIALLLNRNNMA
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 24-270aa
Sequence Info: Full Length of Mature Protein
MW: 29.1 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Inactivates eukaryotic 60S ribosomal subunits.
Reference: "Crystal structures of the complexes of trichosanthin with four substrate analogs and catalytic mechanism of RNA N-glycosidase."Gu Y.J., Xia Z.X.Proteins 39:37-46(2000)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Inactivates eukaryotic 60S ribosomal subunits.
Involvement in disease:
Subcellular Location:
Protein Families: Ribosome-inactivating protein family, Type 1 RIP subfamily
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P09989
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A