Recombinant Treponema pallidum 34 kDa membrane antigen (tpd) | CSB-EP322536TPR

Recombinant Treponema pallidum 34 kDa membrane antigen (tpd) | CSB-EP322536TPR | Cusabio

Alternative Name(s): Pathogen-specific membrane antigen

Gene Names: tpd

Research Areas: Cancer

Organism: Treponema pallidum (strain Nichols)

AA Sequence: CGGGGEHQHGEEMMAAVPAPDAEGAAGFDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 20-204aa

Sequence Info: Full Length of Mature Protein

MW: 27.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: This antigen is a pathogen-specific membrane immunogen.

Reference: "The binary protein interactome of Treponema pallidum--the syphilis spirochete." Titz B., Rajagopala S.V., Goll J., Hauser R., McKevitt M.T., Palzkill T., Uetz P. PLoS ONE 3:e2292-e2292(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: This antigen is a pathogen-specific membrane immunogen.

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor

Protein Families: UPF0423 family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P19478

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A